- Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00610 (AtMg00610)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1165883
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 17,843 Da
- E Coli or Yeast
- 1-161
- Uncharacterized mitochondrial protein AtMg00610 (AtMg00610)
- T18C6.24, T18C6_24
Sequence
MLYGLRLYAFQEISFLDPWQLAAIFSGSCVLFISLEKRTLTGYMLTFILYSVLALFVSVWLSSAAGKAGIPIEGMVFLLFLIGGICFICLIQKIFQLTPNTVQALIPILFSALFFFLEELPALEGLPLLKWLKGLDLLLLLVGLLLLIFNENRQGGDGEGS